The 1.1.1.1 DNS over Discord bot allows you to run DNS lookups and WHOIS queries directly inside Discord, which is useful when you are debugging DNS issues collaboratively or need quick record checks without switching to a terminal.
Invite the bot to your Discord server ↗︎ to make it available in that server's channels, or add the bot to your Discord account ↗︎ to use it anywhere in Discord.
Once the bot is in your server, type /dig to start performing DNS lookups. Discord will display a slash command form where you specify the domain to look up, an optional DNS record type, and an optional flag for a short result.
A DNS lookup queries the Domain Name System to retrieve records associated with a domain (for example, the IP addresses a domain points to, or the mail servers it uses).
If only a domain is given for the command, the bot defaults to looking for A records (which map a domain to one or more IPv4 addresses) and returns the full format result, not the short form.
Example:
/dig domain: cloudflare.comDiscord has a limit of 25 options in slash commands, so DNS over Discord offers the 25 most common DNS record types to choose from.
Supported DNS record types
AAAAACAACDNSKEYCDSCERTCNAMEDNSKEYDSHINFOHTTPSLOCMXNAPTRNSPTRSMIMEASOASPFSRVSSHFPSVCBTLSATXTURI
To query other DNS record types, or multiple record types at once, use the /multi-dig command.
The /dig command has an optional flag to request a short form response.
When you request a response in the short form, the name and TTL (time-to-live, how long the record is cached) columns are excluded. The command returns only the record data without formatting, similar to the equivalent dig command-line interface response.
Example:
/dig domain: cloudflare.com type: AAAA records short: TrueDNSSEC (Domain Name System Security Extensions) validates that DNS responses have not been tampered with. You can disable this validation in the /dig command by passing cdflag as true, which is useful when troubleshooting domains with misconfigured DNSSEC, where validation failures block otherwise valid records from appearing.
Example:
/dig domain: cloudflare.com type: AAAA records cdflag: TrueYou can refresh the DNS lookup results by clicking the Refresh button. Clicking it will trigger the bot to re-request the DNS query in the message, and update the results in the message. Any user can click this button.
The refresh button is available on all responses to the /dig command, including those that resulted in an error, such as an unknown domain or no records found.
By default, the DNS over Discord bot uses Cloudflare's 1.1.1.1 DNS service. To compare results across providers (for example, to check whether a DNS propagation issue is provider-specific) select a different provider from the dropdown below the result. The results in the message update to reflect the selected provider. Any user can change the DNS provider.
If you want to look up multiple DNS record types at once, use the /multi-dig command. This allows you to specify any supported DNS record type, and multiple types separated by a space.
Example:
/multi-dig domain: cloudflare.com types: A AAAAUnlike /dig, the /multi-dig command does not show an autocomplete menu for record types. You provide a space-separated list of DNS record types to look up.
If you include an invalid record type, the bot drops it without an error message. So if results seem incomplete, check for typos in your type list. If no valid types are provided, the bot defaults to A records.
DNS record types supported and considered valid by the bot
Use a * (asterisk) in place of a record type to get DNS results for all supported types.
AAAAAAFSDBAPLCAACDNSKEYCDSCERTCNAMECSYNCDHCIDDLVDNAMEDNSKEYDSEUI48EUI64HINFOHIPHTTPSIPSECKEYKEYKXLOCMXNAPTRNSNSECNSEC3NSEC3PARAMOPENPGPKEYPTRRPSMIMEASOASPFSRVSSHFPSVCBTATKEYTLSATXTURIZONEMD
Like the main /dig command, the /multi-dig command also supports the optional short flag after the types have been specified in the slash command.
Example:
/multi-dig domain: cloudflare.com types: CDS CDNSKEY short: TrueAs with the dig command, you can disable DNSSEC checking by passing cdflag as true. This will return the DNS records even if the DNSSEC validation fails.
Example:
/multi-dig domain: cloudflare.com type: AAAA records cdflag: TrueThe /multi-dig command also provides a refresh button below each set of DNS results requested (or after each block of 10 DNS record types, if you requested more than 10).
As with the /dig command, any user can press the refresh button to refresh the displayed DNS results, including for DNS queries that had previously failed.
Like the /dig command, you can change the DNS provider when using the /multi-dig command. The menu appears after each set of DNS results (or after each block of results if more than 10 record types are requested).
This menu can be used by any user to change the DNS provider used for the lookup.
The /whois command performs a RDAP/WHOIS lookup in Discord for a given domain, IP address, or ASN (Autonomous System Number, a unique identifier assigned to a network). WHOIS returns registration and ownership information, such as who registered a domain and when it expires.
Examples:
/whois query: cloudflare.com
/whois query: 104.16.132.229
/whois query: 2606:4700::6810:84e5
/whois query: 13335The bot also has a set of helper commands available to get more information about the bot and quick links.
The /help command provides in-Discord documentation about all the commands available in the 1.1.1.1 DNS over Discord bot.
Example:
/helpThe /privacy command displays the Privacy Policy notice for using the 1.1.1.1 DNS over Discord bot. You can also refer to the Privacy Policy page ↗︎ to access it.
Example:
/privacyThe /terms command displays the Terms of Service notice for using the 1.1.1.1 DNS over Discord bot. You can also refer to the Terms of Service page ↗︎ to access it.
Example:
/termsThe DNS over Discord bot is open-source, and the /github command provides a quick link to access the GitHub repository. The GitHub repository can be accessed at https://github.com/MattIPv4/DNS-over-Discord/ ↗︎.
Example:
/githubThe /invite command provides the user with a quick link to invite the 1.1.1.1 DNS over Discord bot to another Discord server, or to add it to a Discord account.
The bot can be invited at any time with https://cfl.re/3nM6VfQ ↗︎.
The bot can also be added to accounts with https://dns-over-discord.v4.wtf/invite/user ↗︎.
/inviteThe DNS over Discord bot is deployed on Cloudflare Workers ↗︎.
You can find the source code for the bot on GitHub, as well as information on getting started with contributing to the project, at https://github.com/MattIPv4/DNS-over-Discord/ ↗︎.

